Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (26 families) |
Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
Protein automated matches [190220] (14 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [311380] (11 PDB entries) |
Domain d4hola4: 4hol A:634-963 [307521] Other proteins in same PDB: d4hola1, d4hola2, d4hola3, d4hola5 automated match to d4fyta4 complexed with nag, zn |
PDB Entry: 4hol (more details), 2.1 Å
SCOPe Domain Sequences for d4hola4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hola4 a.118.1.0 (A:634-963) automated matches {Pig (Sus scrofa) [TaxId: 9823]} dnwrmiqhqlqtnlsvipvinraqviydsfnlatahmvpvtlaldntlflngekeympwq aalsslsyfslmfdrsevygpmkkylrkqveplfqhfetltknwterpenlmdqyseina istacsnglpqcenlaktlfdqwmsdpennpihpnlrstiycnaiaqggqdqwdfawgql qqaqlvneadklrsalacsnevwllnrylgytlnpdlirkqdatstinsiasnvigqpla wdfvqsnwkklfqdygggsfsfsnliqgvtrrfssefelqqleqfkknnmdvgfgsgtra leqalektkanikwvkenkevvlnwfiehs
Timeline for d4hola4:
View in 3D Domains from same chain: (mouse over for more information) d4hola1, d4hola2, d4hola3, d4hola5 |