Lineage for d4hola3 (4hol A:545-633)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766973Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2766995Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. 2766996Protein automated matches [254707] (4 species)
    not a true protein
  7. 2767040Species Pig (Sus scrofa) [TaxId:9823] [311379] (18 PDB entries)
  8. 2767046Domain d4hola3: 4hol A:545-633 [307520]
    Other proteins in same PDB: d4hola1, d4hola2, d4hola4, d4hola5
    automated match to d4fyta3
    complexed with nag, zn

Details for d4hola3

PDB Entry: 4hol (more details), 2.1 Å

PDB Description: Crystal structure of porcine aminopeptidase-N complexed with poly-alanine
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4hola3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hola3 b.1.30.0 (A:545-633) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
fpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvsqa
qndlfktasddwvllnvnvtgyfqvnyde

SCOPe Domain Coordinates for d4hola3:

Click to download the PDB-style file with coordinates for d4hola3.
(The format of our PDB-style files is described here.)

Timeline for d4hola3: