SCOPe 2.06: Domain d4hfgb_: 4hfg B:

Lineage for d4hfgb_ (4hfg B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.9: ENTH/VHS domain [48464] (5 families)

5. Family a.118.9.4: RNA Polymerase II carboxy-terminal domain (CTD)-interacting (CID) domain (RPR domain) [109975] (4 proteins)
   found in proteins involved in regulation of nuclear pre-mRNA; some sequence similarity to VHS domain
   SMART 00582; Pfam PF04818

6. Protein RPRD1B [310742] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [310995] (3 PDB entries)

8. Domain d4hfgb_: 4hfg B: [307515]
   automated match to d4fu3a_
   complexed with so4, unx

Details for d4hfgb_

PDB Entry: 4hfg, 2 Å

PDB Description: cid of human rprd1b

PDB Compounds: (B:) Regulation of nuclear pre-mRNA domain-containing protein 1B

SCOPe Domain Sequences for d4hfgb_:

Sequence; same for both SEQRES and ATOM records:

>d4hfgb_ a.118.9.4 (B:) RPRD1B {Human (Homo sapiens) [TaxId: 9606]}
sfsesalekklselsnsqhsvqtlslwlihhrkhagpivsvwhrelrkaksnrkltflyl
andviqnskrkgpeftrefesvlvdafshvareadegckkplerllniwqersvyggefi
qqlklsme

Timeline for d4hfgb_:

• d4hfgb_ is new in SCOPe 2.06-stable
  
• d4hfgb_ appears in SCOPe 2.07
  
• d4hfgb_ appears in the current release, SCOPe 2.08