Lineage for d1ce8h1 (1ce8 H:2-152)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 577176Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (9 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 577232Superfamily c.8.3: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52021] (1 family) (S)
  5. 577233Family c.8.3.1: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52022] (1 protein)
  6. 577234Protein Carbamoyl phosphate synthetase, small subunit N-terminal domain [52023] (1 species)
  7. 577235Species Escherichia coli [TaxId:562] [52024] (10 PDB entries)
  8. 577263Domain d1ce8h1: 1ce8 H:2-152 [30751]
    Other proteins in same PDB: d1ce8a1, d1ce8a2, d1ce8a3, d1ce8a4, d1ce8a5, d1ce8a6, d1ce8b2, d1ce8c1, d1ce8c2, d1ce8c3, d1ce8c4, d1ce8c5, d1ce8c6, d1ce8d2, d1ce8e1, d1ce8e2, d1ce8e3, d1ce8e4, d1ce8e5, d1ce8e6, d1ce8f2, d1ce8g1, d1ce8g2, d1ce8g3, d1ce8g4, d1ce8g5, d1ce8g6, d1ce8h2
    complexed with adp, cl, imp, k, mn, net, orn, pi

Details for d1ce8h1

PDB Entry: 1ce8 (more details), 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichis coli with complexed with the allosteric ligand imp

SCOP Domain Sequences for d1ce8h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ce8h1 c.8.3.1 (H:2-152) Carbamoyl phosphate synthetase, small subunit N-terminal domain {Escherichia coli}
iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
lrekgaqngciiagdnpdaalalekarafpg

SCOP Domain Coordinates for d1ce8h1:

Click to download the PDB-style file with coordinates for d1ce8h1.
(The format of our PDB-style files is described here.)

Timeline for d1ce8h1: