Lineage for d1ce8h1 (1ce8 H:2-152)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119570Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 119616Superfamily c.8.3: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52021] (1 family) (S)
  5. 119617Family c.8.3.1: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52022] (1 protein)
  6. 119618Protein Carbamoyl phosphate synthetase, small subunit N-terminal domain [52023] (1 species)
  7. 119619Species Escherichia coli [TaxId:562] [52024] (8 PDB entries)
  8. 119647Domain d1ce8h1: 1ce8 H:2-152 [30751]
    Other proteins in same PDB: d1ce8a1, d1ce8a2, d1ce8a3, d1ce8a4, d1ce8a5, d1ce8a6, d1ce8b2, d1ce8c1, d1ce8c2, d1ce8c3, d1ce8c4, d1ce8c5, d1ce8c6, d1ce8d2, d1ce8e1, d1ce8e2, d1ce8e3, d1ce8e4, d1ce8e5, d1ce8e6, d1ce8f2, d1ce8g1, d1ce8g2, d1ce8g3, d1ce8g4, d1ce8g5, d1ce8g6, d1ce8h2

Details for d1ce8h1

PDB Entry: 1ce8 (more details), 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichis coli with complexed with the allosteric ligand imp

SCOP Domain Sequences for d1ce8h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ce8h1 c.8.3.1 (H:2-152) Carbamoyl phosphate synthetase, small subunit N-terminal domain {Escherichia coli}
iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
lrekgaqngciiagdnpdaalalekarafpg

SCOP Domain Coordinates for d1ce8h1:

Click to download the PDB-style file with coordinates for d1ce8h1.
(The format of our PDB-style files is described here.)

Timeline for d1ce8h1: