Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.223: Polo-box domain [82614] (1 superfamily) beta(6)-alpha; antiparallel beta-sheet, meander |
Superfamily d.223.1: Polo-box domain [82615] (3 families) Serine/threonine protein kinase-associated motif embedded in two distinct folds |
Family d.223.1.2: Polo-box duplicated region [102856] (1 protein) duplication: consists of two polo-box domains; binds phosphothreonine peptide |
Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [102858] (23 PDB entries) |
Domain d4h70a2: 4h70 A:501-593 [307509] automated match to d4o6wa2 complexed with gol, imw |
PDB Entry: 4h70 (more details), 2.75 Å
SCOPe Domain Sequences for d4h70a2:
Sequence, based on SEQRES records: (download)
>d4h70a2 d.223.1.2 (A:501-593) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} egdelarlpylrtwfrtrsaiilhlsngsvqinffqdhtklilcplmaavtyidekrdfr tyrlslleeygcckelasrlryartmvdkllss
>d4h70a2 d.223.1.2 (A:501-593) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} egdlarlpylrtwfrtrsaiilhlsngsvqinffqdhtklilcplmaavtyidekrdfrt yrlslleeygcckelasrlryartmvdkllss
Timeline for d4h70a2: