SCOPe 2.06: Domain d4h5qb_: 4h5q B:

Lineage for d4h5qb_ (4h5q B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.299: Tenuivirus/Phlebovirus nucleocapsid protein-like [310560] (1 superfamily)

4. Superfamily a.299.1: Tenuivirus/Phlebovirus nucleocapsid protein [310587] (1 family)
   Pfam PF05733

5. Family a.299.1.1: Phlebovirus nucleocapsid protein [310634] (3 proteins)

6. Protein Rift Valley fever virus (RVFV) N protein [310764] (1 species)

7. Species Rift Valley fever virus [TaxId:11588] [311019] (6 PDB entries)

8. Domain d4h5qb_: 4h5q B: [307506]
   automated match to d3lyfa_
   protein/DNA complex; protein/RNA complex

Details for d4h5qb_

PDB Entry: 4h5q, 2.7 Å

PDB Description: Crystal Structure of Rift Valley Fever Virus Nucleocapsid Protein Hexamer Bound to Single-stranded DNA

PDB Compounds: (B:) nucleocapsid protein

SCOPe Domain Sequences for d4h5qb_:

Sequence; same for both SEQRES and ATOM records:

>d4h5qb_ a.299.1.1 (B:) Rift Valley fever virus (RVFV) N protein {Rift Valley fever virus [TaxId: 11588]}
nyqelaiqfaaqavdrneieqwvrefayqgfdarrviellkqyggadwekdakkmivlal
trgnkprrmmmkmskegkatvealinkyklkegnpsrdeltlsrvaaalagrtcqalvvl
sewlpvtgttmdglspayprhmmhpsfagmvdpslpgdylraildahslyllqfsrvinp
nlrgrtkeevaatftqpmnaavnsnfishekrreflkafglvdsngkpsaavmaaaqayk
taa

Timeline for d4h5qb_:

• d4h5qb_ is new in SCOPe 2.06-stable
  
• d4h5qb_ appears in SCOPe 2.07
  
• d4h5qb_ appears in the current release, SCOPe 2.08