Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.3: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52021] (1 family) |
Family c.8.3.1: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52022] (1 protein) |
Protein Carbamoyl phosphate synthetase, small subunit N-terminal domain [52023] (1 species) |
Species Escherichia coli [TaxId:562] [52024] (10 PDB entries) Uniprot P00907 |
Domain d1ce8f1: 1ce8 F:2-152 [30750] Other proteins in same PDB: d1ce8a1, d1ce8a2, d1ce8a3, d1ce8a4, d1ce8a5, d1ce8a6, d1ce8b2, d1ce8c1, d1ce8c2, d1ce8c3, d1ce8c4, d1ce8c5, d1ce8c6, d1ce8d2, d1ce8e1, d1ce8e2, d1ce8e3, d1ce8e4, d1ce8e5, d1ce8e6, d1ce8f2, d1ce8g1, d1ce8g2, d1ce8g3, d1ce8g4, d1ce8g5, d1ce8g6, d1ce8h2 |
PDB Entry: 1ce8 (more details), 2.1 Å
SCOP Domain Sequences for d1ce8f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ce8f1 c.8.3.1 (F:2-152) Carbamoyl phosphate synthetase, small subunit N-terminal domain {Escherichia coli [TaxId: 562]} iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl lrekgaqngciiagdnpdaalalekarafpg
Timeline for d1ce8f1:
View in 3D Domains from other chains: (mouse over for more information) d1ce8a1, d1ce8a2, d1ce8a3, d1ce8a4, d1ce8a5, d1ce8a6, d1ce8b1, d1ce8b2, d1ce8c1, d1ce8c2, d1ce8c3, d1ce8c4, d1ce8c5, d1ce8c6, d1ce8d1, d1ce8d2, d1ce8e1, d1ce8e2, d1ce8e3, d1ce8e4, d1ce8e5, d1ce8e6, d1ce8g1, d1ce8g2, d1ce8g3, d1ce8g4, d1ce8g5, d1ce8g6, d1ce8h1, d1ce8h2 |