Lineage for d4h5md_ (4h5m D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739394Fold a.299: Tenuivirus/Phlebovirus nucleocapsid protein-like [310560] (1 superfamily)
  4. 2739395Superfamily a.299.1: Tenuivirus/Phlebovirus nucleocapsid protein [310587] (1 family) (S)
    Pfam PF05733
  5. 2739396Family a.299.1.1: Phlebovirus nucleocapsid protein [310634] (3 proteins)
  6. 2739397Protein Rift Valley fever virus (RVFV) N protein [310764] (1 species)
  7. 2739398Species Rift Valley fever virus [TaxId:11588] [311019] (6 PDB entries)
  8. 2739419Domain d4h5md_: 4h5m D: [307498]
    automated match to d3lyfa_
    complexed with so4

Details for d4h5md_

PDB Entry: 4h5m (more details), 3.1 Å

PDB Description: Crystal Structure of Rift Valley Fever Virus Nucleocapsid Protein Hexamer
PDB Compounds: (D:) nucleocapsid protein

SCOPe Domain Sequences for d4h5md_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h5md_ a.299.1.1 (D:) Rift Valley fever virus (RVFV) N protein {Rift Valley fever virus [TaxId: 11588]}
dnyqelaiqfaaqavdrneieqwvrefayqgfdarrviellkqyggadwekdakkmivla
ltrgnkprrmmmkmskegkatvealinkyklkegnpsrdeltlsrvaaalagrtcqalvv
lsewlpvtgttmdglspayprhmmhpsfagmvdpslpgdylraildahslyllqfsrvin
pnlrgrtkeevaatftqpmnaavnsnfishekrreflkafglvdsngkpsaavmaaaqay
ktaa

SCOPe Domain Coordinates for d4h5md_:

Click to download the PDB-style file with coordinates for d4h5md_.
(The format of our PDB-style files is described here.)

Timeline for d4h5md_: