![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.299: Tenuivirus/Phlebovirus nucleocapsid protein-like [310560] (1 superfamily) |
![]() | Superfamily a.299.1: Tenuivirus/Phlebovirus nucleocapsid protein [310587] (1 family) ![]() Pfam PF05733 |
![]() | Family a.299.1.1: Phlebovirus nucleocapsid protein [310634] (3 proteins) |
![]() | Protein Rift Valley fever virus (RVFV) N protein [310764] (1 species) |
![]() | Species Rift Valley fever virus [TaxId:11588] [311019] (6 PDB entries) |
![]() | Domain d4h5ma_: 4h5m A: [307495] automated match to d3lyfa_ complexed with so4 |
PDB Entry: 4h5m (more details), 3.1 Å
SCOPe Domain Sequences for d4h5ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h5ma_ a.299.1.1 (A:) Rift Valley fever virus (RVFV) N protein {Rift Valley fever virus [TaxId: 11588]} nyqelaiqfaaqavdrneieqwvrefayqgfdarrviellkqyggadwekdakkmivlal trgnkprrmmmkmskegkatvealinkyklkegnpsrdeltlsrvaaalagrtcqalvvl sewlpvtgttmdglspayprhmmhpsfagmvdpslpgdylraildahslyllqfsrvinp nlrgrtkeevaatftqpmnaavnsnfishekrreflkafglvdsngkpsaavmaaaqayk taa
Timeline for d4h5ma_: