Lineage for d4h5le_ (4h5l E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739394Fold a.299: Tenuivirus/Phlebovirus nucleocapsid protein-like [310560] (1 superfamily)
  4. 2739395Superfamily a.299.1: Tenuivirus/Phlebovirus nucleocapsid protein [310587] (1 family) (S)
    Pfam PF05733
  5. 2739396Family a.299.1.1: Phlebovirus nucleocapsid protein [310634] (3 proteins)
  6. 2739422Protein Toscana virus N protein [310765] (2 species)
    domain swapped hexamer
  7. 2739425Species Toscana virus [TaxId:11590] [311020] (1 PDB entry)
  8. 2739430Domain d4h5le_: 4h5l E: [307493]

Details for d4h5le_

PDB Entry: 4h5l (more details), 2.75 Å

PDB Description: Crystal Structure of Toscana Virus Nucleocapsid Protein Hexamer
PDB Compounds: (E:) nucleoprotein

SCOPe Domain Sequences for d4h5le_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h5le_ a.299.1.1 (E:) Toscana virus N protein {Toscana virus [TaxId: 11590]}
nyrdialafldesadsgtinawvnefayqgfdpkrivqlvkergtakgrdwkkdvkmmiv
lnlvrgnkpeammkkmsekgasivanlisvyqlkegnpgrdtitlsrvsaafvpwtvqal
rvlseslpvsgttmdaiagvtyprammhpsfagiidldlpngagatiadahglfmiefsk
tinpslrtkqanevaatfekpnmaamsgrfftredkkklliavgiidedlvlasavvrsa
ekyr

SCOPe Domain Coordinates for d4h5le_:

Click to download the PDB-style file with coordinates for d4h5le_.
(The format of our PDB-style files is described here.)

Timeline for d4h5le_: