| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) ![]() same topology as (b.1.15.1) |
| Family b.1.30.0: automated matches [254306] (1 protein) not a true family |
| Protein automated matches [254707] (4 species) not a true protein |
| Species Pig (Sus scrofa) [TaxId:9823] [311379] (18 PDB entries) |
| Domain d4h5ha3: 4h5h A:545-633 [307486] Other proteins in same PDB: d4h5ha1, d4h5ha2, d4h5ha4, d4h5ha5 automated match to d4fyta3 complexed with ala, nag, zn |
PDB Entry: 4h5h (more details), 2 Å
SCOPe Domain Sequences for d4h5ha3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h5ha3 b.1.30.0 (A:545-633) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
fpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvsqa
qndlfktasddwvllnvnvtgyfqvnyde
Timeline for d4h5ha3:
View in 3DDomains from same chain: (mouse over for more information) d4h5ha1, d4h5ha2, d4h5ha4, d4h5ha5 |