SCOPe 2.08: Domain d4h5ha2: 4h5h A:283-544

Lineage for d4h5ha2 (4h5h A:283-544)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.0: automated matches [191495] (1 protein)
   not a true family

6. Protein automated matches [190805] (20 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [311378] (18 PDB entries)

8. Domain d4h5ha2: 4h5h A:283-544 [307485]
   Other proteins in same PDB: d4h5ha1, d4h5ha3, d4h5ha4, d4h5ha5
   automated match to d4fyta2
   complexed with ala, nag, zn

Details for d4h5ha2

PDB Entry: 4h5h, 2 Å

PDB Description: Crystal structure of porcine aminopeptidase-N complexed with cleaved poly-alanine

PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4h5ha2:

Sequence; same for both SEQRES and ATOM records:

>d4h5ha2 d.92.1.0 (A:283-544) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
qsvnetaqngvliriwarpnaiaeghgmyalnvtgpilnffanhyntsyplpksdqialp
dfnagamenwglvtyrenallfdpqsssisnkervvtviahelahqwfgnlvtlawwndl
wlnegfasyveylgadhaeptwnlkdlivpgdvyrvmavdalasshplttpaeevntpaq
isemfdsisyskgasvirmlsnfltedlfkeglasylhafayqnttyldlwehlqkavda
qtsirlpdtvraimdrwtlqmg

Timeline for d4h5ha2:

• d4h5ha2 first appeared in SCOPe 2.06
  
• d4h5ha2 appears in SCOPe 2.07