![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
![]() | Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
![]() | Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
![]() | Protein automated matches [190139] (27 species) not a true protein |
![]() | Species Viridovipera stejnegeri [TaxId:39682] [194681] (3 PDB entries) |
![]() | Domain d4h0qb_: 4h0q B: [307483] automated match to d4rfpa_ complexed with peg |
PDB Entry: 4h0q (more details), 1.6 Å
SCOPe Domain Sequences for d4h0qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h0qb_ a.133.1.2 (B:) automated matches {Viridovipera stejnegeri [TaxId: 39682]} nlmqfellimkvagrsgivwysdygcfcgkgghgrpqdatdrccfvhdccygkvngcdpk edfyryssnngdivceannpctkeicecdkaaaicfrdnkdtydnkywnipmescqesep c
Timeline for d4h0qb_: