SCOPe 2.08: Domain d4h0qa_: 4h0q A:

Lineage for d4h0qa_ (4h0q A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein automated matches [190139] (27 species)
   not a true protein

7. Species Viridovipera stejnegeri [TaxId:39682] [194681] (3 PDB entries)

8. Domain d4h0qa_: 4h0q A: [307482]
   automated match to d4rfpa_
   complexed with peg

Details for d4h0qa_

PDB Entry: 4h0q, 1.6 Å

PDB Description: Crystal structure of a acidic PLA2 from Trimeresurus stejnegeri venom

PDB Compounds: (A:) Phospholipase A2, acid 5

SCOPe Domain Sequences for d4h0qa_:

Sequence; same for both SEQRES and ATOM records:

>d4h0qa_ a.133.1.2 (A:) automated matches {Viridovipera stejnegeri [TaxId: 39682]}
nlmqfellimkvagrsgivwysdygcfcgkgghgrpqdatdrccfvhdccygkvngcdpk
edfyryssnngdivceannpctkeicecdkaaaicfrdnkdtydnkywnipmescqesep
c

Timeline for d4h0qa_:

• d4h0qa_ first appeared in SCOPe 2.06
  
• d4h0qa_ appears in SCOPe 2.07