Lineage for d4gwhb3 (4gwh B:2-115)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944662Species Yersinia pestis [TaxId:187410] [226504] (3 PDB entries)
  8. 2944665Domain d4gwhb3: 4gwh B:2-115 [307468]
    automated match to d4qfwd2

Details for d4gwhb3

PDB Entry: 4gwh (more details), 2 Å

PDB Description: Crystal structure of acyl-CoA thioesterase tesB from Yersinia pestis
PDB Compounds: (B:) acyl-coa thioesterase II

SCOPe Domain Sequences for d4gwhb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gwhb3 d.38.1.0 (B:2-115) automated matches {Yersinia pestis [TaxId: 187410]}
sqaleklldlldlekieegifrgqsedlglrqvfggqvvgqaiyaakqtvpaertvhsfh
syflrpgdsskpiiydvetlrdgnsfsarrvsaiqngkpifymtasfqsqeegf

SCOPe Domain Coordinates for d4gwhb3:

Click to download the PDB-style file with coordinates for d4gwhb3.
(The format of our PDB-style files is described here.)

Timeline for d4gwhb3: