SCOPe 2.08: Domain d4gwhb3: 4gwh B:2-115

Lineage for d4gwhb3 (4gwh B:2-115)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (42 species)
   not a true protein

7. Species Yersinia pestis [TaxId:187410] [226504] (3 PDB entries)

8. Domain d4gwhb3: 4gwh B:2-115 [307468]
   automated match to d4qfwd2

Details for d4gwhb3

PDB Entry: 4gwh, 2 Å

PDB Description: Crystal structure of acyl-CoA thioesterase tesB from Yersinia pestis

PDB Compounds: (B:) acyl-coa thioesterase II

SCOPe Domain Sequences for d4gwhb3:

Sequence; same for both SEQRES and ATOM records:

>d4gwhb3 d.38.1.0 (B:2-115) automated matches {Yersinia pestis [TaxId: 187410]}
sqaleklldlldlekieegifrgqsedlglrqvfggqvvgqaiyaakqtvpaertvhsfh
syflrpgdsskpiiydvetlrdgnsfsarrvsaiqngkpifymtasfqsqeegf

Timeline for d4gwhb3:

• d4gwhb3 first appeared in SCOPe 2.06
  
• d4gwhb3 appears in SCOPe 2.07