SCOP 1.75: Domain d1c3of1: 1c3o F:2-152

Lineage for d1c3of1 (1c3o F:2-152)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.3: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52021] (1 family)

5. Family c.8.3.1: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52022] (1 protein)

6. Protein Carbamoyl phosphate synthetase, small subunit N-terminal domain [52023] (1 species)

7. Species Escherichia coli [TaxId:562] [52024] (10 PDB entries)
   Uniprot P00907

8. Domain d1c3of1: 1c3o F:2-152 [30746]
   Other proteins in same PDB: d1c3oa1, d1c3oa2, d1c3oa3, d1c3oa4, d1c3oa5, d1c3oa6, d1c3ob2, d1c3oc1, d1c3oc2, d1c3oc3, d1c3oc4, d1c3oc5, d1c3oc6, d1c3od2, d1c3oe1, d1c3oe2, d1c3oe3, d1c3oe4, d1c3oe5, d1c3oe6, d1c3of2, d1c3og1, d1c3og2, d1c3og3, d1c3og4, d1c3og5, d1c3og6, d1c3oh2

Details for d1c3of1

PDB Entry: 1c3o, 2.1 Å

PDB Description: crystal structure of the carbamoyl phosphate synthetase: small subunit mutant c269s with bound glutamine

PDB Compounds: (F:) carbamoyl phosphate synthetase: small subunit

SCOP Domain Sequences for d1c3of1:

Sequence; same for both SEQRES and ATOM records:

>d1c3of1 c.8.3.1 (F:2-152) Carbamoyl phosphate synthetase, small subunit N-terminal domain {Escherichia coli [TaxId: 562]}
iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
lrekgaqngciiagdnpdaalalekarafpg

Timeline for d1c3of1:

• d1c3of1 first appeared (with stable ids) in SCOP 1.55
  
• d1c3of1 appears in SCOP 1.73
  
• d1c3of1 appears in SCOPe 2.01
  
• d1c3of1 appears in the current release, SCOPe 2.08