![]() | Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
![]() | Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies) |
![]() | Superfamily c.8.3: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52021] (1 family) ![]() |
![]() | Family c.8.3.1: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52022] (1 protein) |
![]() | Protein Carbamoyl phosphate synthetase, small subunit N-terminal domain [52023] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [52024] (7 PDB entries) |
![]() | Domain d1c3of1: 1c3o F:2-152 [30746] Other proteins in same PDB: d1c3oa1, d1c3oa2, d1c3oa3, d1c3oa4, d1c3oa5, d1c3oa6, d1c3ob2, d1c3oc1, d1c3oc2, d1c3oc3, d1c3oc4, d1c3oc5, d1c3oc6, d1c3od2, d1c3oe1, d1c3oe2, d1c3oe3, d1c3oe4, d1c3oe5, d1c3oe6, d1c3of2, d1c3og1, d1c3og2, d1c3og3, d1c3og4, d1c3og5, d1c3og6, d1c3oh2 |
PDB Entry: 1c3o (more details), 2.1 Å
SCOP Domain Sequences for d1c3of1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c3of1 c.8.3.1 (F:2-152) Carbamoyl phosphate synthetase, small subunit N-terminal domain {Escherichia coli} iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl lrekgaqngciiagdnpdaalalekarafpg
Timeline for d1c3of1:
![]() Domains from other chains: (mouse over for more information) d1c3oa1, d1c3oa2, d1c3oa3, d1c3oa4, d1c3oa5, d1c3oa6, d1c3ob1, d1c3ob2, d1c3oc1, d1c3oc2, d1c3oc3, d1c3oc4, d1c3oc5, d1c3oc6, d1c3od1, d1c3od2, d1c3oe1, d1c3oe2, d1c3oe3, d1c3oe4, d1c3oe5, d1c3oe6, d1c3og1, d1c3og2, d1c3og3, d1c3og4, d1c3og5, d1c3og6, d1c3oh1, d1c3oh2 |