Lineage for d4gf5c_ (4gf5 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894401Family c.66.1.61: TylF O-methyltransferase-like [310662] (4 proteins)
    Pfam PF05711
  6. 2894435Protein automated matches [310884] (2 species)
    not a true protein
  7. 2894436Species Micromonospora echinospora [TaxId:1877] [311383] (2 PDB entries)
  8. 2894444Domain d4gf5c_: 4gf5 C: [307433]
    automated match to d3tosb_
    complexed with sah, so4

Details for d4gf5c_

PDB Entry: 4gf5 (more details), 2.2 Å

PDB Description: crystal structure of calicheamicin methyltransferase, cals11
PDB Compounds: (C:) CalS11

SCOPe Domain Sequences for d4gf5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gf5c_ c.66.1.61 (C:) automated matches {Micromonospora echinospora [TaxId: 1877]}
qdlrafvhdspeetettqrltklltnspipteelvnnlplflrrhqmtdllsmdalyrqv
ldvpgvimefgvrfgrhlgtfaalrgvyepynplrrivgfdtftgfpdvndvdrvgptay
qgrfavpggypaylkevldahecsdffghvtqrsvlvegdvretvprylaenpqtviala
yfdldlyeptkavleairpyltkgsivafdeldnpkwpgeniamrkvlgldhaplrllpg
rpapaylrwgd

SCOPe Domain Coordinates for d4gf5c_:

Click to download the PDB-style file with coordinates for d4gf5c_.
(The format of our PDB-style files is described here.)

Timeline for d4gf5c_: