![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.16: Lumazine synthase [52120] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.16.1: Lumazine synthase [52121] (2 families) ![]() |
![]() | Family c.16.1.1: Lumazine synthase [52122] (2 proteins) |
![]() | Protein automated matches [190461] (5 species) not a true protein |
![]() | Species Candida glabrata [TaxId:284593] [193568] (2 PDB entries) |
![]() | Domain d4gefg_: 4gef G: [307427] automated match to d4kq6d_ complexed with dlz, gol, so4 |
PDB Entry: 4gef (more details), 2.24 Å
SCOPe Domain Sequences for d4gefg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gefg_ c.16.1.1 (G:) automated matches {Candida glabrata [TaxId: 284593]} qldqnydgsklrvgiiharwnrviidalvkgaidrmlslgvkeeniivetvpgsfelpyg skrfaekqakkgepldvvipigvlikgstmhfeyisdsttqaimnlqdkinipvifgllt clteeqalaragidegktmhnhgedwgaaavematkfgan
Timeline for d4gefg_: