Lineage for d4gefe_ (4gef E:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2113861Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2113862Superfamily c.16.1: Lumazine synthase [52121] (2 families) (S)
  5. 2113863Family c.16.1.1: Lumazine synthase [52122] (2 proteins)
  6. 2114022Protein automated matches [190461] (5 species)
    not a true protein
  7. 2114029Species Candida glabrata [TaxId:284593] [193568] (2 PDB entries)
  8. 2114034Domain d4gefe_: 4gef E: [307425]
    automated match to d4kq6d_
    complexed with dlz, gol, so4

Details for d4gefe_

PDB Entry: 4gef (more details), 2.24 Å

PDB Description: Product complex of Lumazine Synthase from Candida glabrata
PDB Compounds: (E:) 6,7-dimethyl-8-ribityllumazine synthase

SCOPe Domain Sequences for d4gefe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gefe_ c.16.1.1 (E:) automated matches {Candida glabrata [TaxId: 284593]}
qnydgsklrvgiiharwnrviidalvkgaidrmlslgvkeeniivetvpgsfelpygskr
faekqakkgepldvvipigvlikgstmhfeyisdsttqaimnlqdkinipvifglltclt
eeqalaragidegktmhnhgedwgaaavematkfgan

SCOPe Domain Coordinates for d4gefe_:

Click to download the PDB-style file with coordinates for d4gefe_.
(The format of our PDB-style files is described here.)

Timeline for d4gefe_: