Lineage for d4gdha_ (4gdh A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2859252Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2859253Protein automated matches [190197] (23 species)
    not a true protein
  7. 2859400Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [226442] (4 PDB entries)
  8. 2859401Domain d4gdha_: 4gdh A: [307417]
    automated match to d4ge3a_
    complexed with edo, mg

Details for d4gdha_

PDB Entry: 4gdh (more details), 1.05 Å

PDB Description: Schizosaccharomyces pombe DJ-1
PDB Compounds: (A:) Uncharacterized protein C22E12.03c

SCOPe Domain Sequences for d4gdha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gdha_ c.23.16.0 (A:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
vkvclfvadgtdeiefsapwgifkraeipidsvyvgenkdrlvkmsrdvemyanrsykei
psaddfakqydiaiipggglgaktlsttpfvqqvvkefykkpnkwigmicagtltaktsg
lpnkqitghpsvrgqleeggykyldqpvvleenlitsqgpgtamlfglklleqvaskdky
navykslsmp

SCOPe Domain Coordinates for d4gdha_:

Click to download the PDB-style file with coordinates for d4gdha_.
(The format of our PDB-style files is described here.)

Timeline for d4gdha_: