Lineage for d1cs0d1 (1cs0 D:2-152)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 979734Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 979813Superfamily c.8.3: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52021] (1 family) (S)
  5. 979814Family c.8.3.1: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52022] (1 protein)
  6. 979815Protein Carbamoyl phosphate synthetase, small subunit N-terminal domain [52023] (1 species)
  7. 979816Species Escherichia coli [TaxId:562] [52024] (10 PDB entries)
    Uniprot P00907
  8. 979826Domain d1cs0d1: 1cs0 D:2-152 [30741]
    Other proteins in same PDB: d1cs0a1, d1cs0a2, d1cs0a3, d1cs0a4, d1cs0a5, d1cs0a6, d1cs0b2, d1cs0c1, d1cs0c2, d1cs0c3, d1cs0c4, d1cs0c5, d1cs0c6, d1cs0d2, d1cs0e1, d1cs0e2, d1cs0e3, d1cs0e4, d1cs0e5, d1cs0e6, d1cs0f2, d1cs0g1, d1cs0g2, d1cs0g3, d1cs0g4, d1cs0g5, d1cs0g6, d1cs0h2
    complexed with adp, cl, k, mn, net, orn, po4

Details for d1cs0d1

PDB Entry: 1cs0 (more details), 2 Å

PDB Description: crystal structure of carbamoyl phosphate synthetase complexed at cys269 in the small subunit with the tetrahedral mimic l-glutamate gamma-semialdehyde
PDB Compounds: (D:) carbamoyl phosphate synthetase: small subunit

SCOPe Domain Sequences for d1cs0d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cs0d1 c.8.3.1 (D:2-152) Carbamoyl phosphate synthetase, small subunit N-terminal domain {Escherichia coli [TaxId: 562]}
iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
lrekgaqngciiagdnpdaalalekarafpg

SCOPe Domain Coordinates for d1cs0d1:

Click to download the PDB-style file with coordinates for d1cs0d1.
(The format of our PDB-style files is described here.)

Timeline for d1cs0d1: