| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.44.3: PIWI domain N-terminal-like [310581] (2 families) ![]() |
| Family c.44.3.0: automated matches [310677] (1 protein) not a true family |
| Protein automated matches [310878] (2 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [311344] (9 PDB entries) |
| Domain d4g0za1: 4g0z A:595-740 [307409] Other proteins in same PDB: d4g0za2 automated match to d3luha_ complexed with 5gp |
PDB Entry: 4g0z (more details), 1.75 Å
SCOPe Domain Sequences for d4g0za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g0za1 c.44.3.0 (A:595-740) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
nkkminggtvnnwicinfsrqvqdnlartfcqelaqmcyvsgmafnpepvlppvsarpeq
vekvlktryhdatsklsqgkeidllivilpdnngslygdlkricetelgivsqccltkhv
fkmskqymanvalkinvkvggrntvl
Timeline for d4g0za1: