Lineage for d4g0oa1 (4g0o A:562-699)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874827Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2875028Superfamily c.44.3: PIWI domain N-terminal-like [310581] (2 families) (S)
  5. 2875080Family c.44.3.0: automated matches [310677] (1 protein)
    not a true family
  6. 2875081Protein automated matches [310878] (2 species)
    not a true protein
  7. 2875093Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [311344] (9 PDB entries)
  8. 2875101Domain d4g0oa1: 4g0o A:562-699 [307398]
    Other proteins in same PDB: d4g0oa2
    automated match to d3luha_
    complexed with so4

Details for d4g0oa1

PDB Entry: 4g0o (more details), 2.19 Å

PDB Description: Crystal structure of Arabidopsis thaliana AGO5 MID domain
PDB Compounds: (A:) Protein argonaute 5

SCOPe Domain Sequences for d4g0oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g0oa1 c.44.3.0 (A:562-699) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dkkmvngakvtswtcvsfstridrglpqefckqligmcvskgmefkpqpaipfiscppeh
ieealldihkrapglqllivilpdvtgsygkikricetelgivsqccqprqvnklnkqym
envalkinvktggrntvl

SCOPe Domain Coordinates for d4g0oa1:

Click to download the PDB-style file with coordinates for d4g0oa1.
(The format of our PDB-style files is described here.)

Timeline for d4g0oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4g0oa2
View in 3D
Domains from other chains:
(mouse over for more information)
d4g0ob_