SCOPe 2.08: Domain d4g0oa1: 4g0o A:562-699

Lineage for d4g0oa1 (4g0o A:562-699)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.3: PIWI domain N-terminal-like [310581] (2 families)

5. Family c.44.3.0: automated matches [310677] (1 protein)
   not a true family

6. Protein automated matches [310878] (2 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [311344] (9 PDB entries)

8. Domain d4g0oa1: 4g0o A:562-699 [307398]
   Other proteins in same PDB: d4g0oa2
   automated match to d3luha_
   complexed with so4

Details for d4g0oa1

PDB Entry: 4g0o, 2.19 Å

PDB Description: Crystal structure of Arabidopsis thaliana AGO5 MID domain

PDB Compounds: (A:) Protein argonaute 5

SCOPe Domain Sequences for d4g0oa1:

Sequence; same for both SEQRES and ATOM records:

>d4g0oa1 c.44.3.0 (A:562-699) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dkkmvngakvtswtcvsfstridrglpqefckqligmcvskgmefkpqpaipfiscppeh
ieealldihkrapglqllivilpdvtgsygkikricetelgivsqccqprqvnklnkqym
envalkinvktggrntvl

Timeline for d4g0oa1:

• d4g0oa1 first appeared in SCOPe 2.06
  
• d4g0oa1 appears in SCOPe 2.07