| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) ![]() |
| Family a.118.9.4: RNA Polymerase II carboxy-terminal domain (CTD)-interacting (CID) domain (RPR domain) [109975] (4 proteins) found in proteins involved in regulation of nuclear pre-mRNA; some sequence similarity to VHS domain SMART 00582; Pfam PF04818 |
| Protein RPRD1B [310742] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [310995] (3 PDB entries) |
| Domain d4fu3b_: 4fu3 B: [307391] complexed with cl, unx |
PDB Entry: 4fu3 (more details), 1.9 Å
SCOPe Domain Sequences for d4fu3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fu3b_ a.118.9.4 (B:) RPRD1B {Human (Homo sapiens) [TaxId: 9606]}
ssfsesalekklselsnsqqsvqtlslwlihhrkhagpivsvwhrelrkaksnrkltfly
landviqnskrkgpeftrefesvlvdafshvareadegckkplerllniwqersvyggef
iqqlklsm
Timeline for d4fu3b_: