Lineage for d4fldb_ (4fld B:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) 
Family a.118.9.4: RNA Polymerase II carboxy-terminal domain (CTD)-interacting (CID) domain (RPR domain) [109975] (4 proteins)
found in proteins involved in regulation of nuclear pre-mRNA; some sequence similarity to VHS domain
SMART 00582; Pfam PF04818
Protein RPRD1B [310742] (1 species) Species Human (Homo sapiens) [TaxId:9606] [310995] (3 PDB entries) 
Domain d4fldb_: 4fld B: [307379]
automated match to d4fu3a_
complexed with so4, unx
Details for d4fldb_
PDB Entry: 4fld (more details), 2 Å
PDB Description: CID of human RPRD1B
PDB Compounds: (B:) Regulation of nuclear pre-mRNA domain-containing protein 1BSCOPe Domain Sequences for d4fldb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fldb_ a.118.9.4 (B:) RPRD1B {Human (Homo sapiens) [TaxId: 9606]}
sfsesalekklselsnsqqsvqtlslwlihhrkhagpivsvwhrelrkaksnrkltflyl
andviqnskrkgpeftrefesvlvdafshvareadegckkplerllniwqersvyggefi
qqlklsme
SCOPe Domain Coordinates for d4fldb_:
Click to download the PDB-style file with coordinates for d4fldb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4fldb_:
- d4fldb_ first appeared in SCOPe 2.06
- d4fldb_ appears in SCOPe 2.07
View in 3D
