Lineage for d1c30d1 (1c30 D:2-152)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 479747Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (8 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 479799Superfamily c.8.3: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52021] (1 family) (S)
  5. 479800Family c.8.3.1: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52022] (1 protein)
  6. 479801Protein Carbamoyl phosphate synthetase, small subunit N-terminal domain [52023] (1 species)
  7. 479802Species Escherichia coli [TaxId:562] [52024] (10 PDB entries)
  8. 479808Domain d1c30d1: 1c30 D:2-152 [30737]
    Other proteins in same PDB: d1c30a1, d1c30a2, d1c30a3, d1c30a4, d1c30a5, d1c30a6, d1c30b2, d1c30c1, d1c30c2, d1c30c3, d1c30c4, d1c30c5, d1c30c6, d1c30d2, d1c30e1, d1c30e2, d1c30e3, d1c30e4, d1c30e5, d1c30e6, d1c30f2, d1c30g1, d1c30g2, d1c30g3, d1c30g4, d1c30g5, d1c30g6, d1c30h2

Details for d1c30d1

PDB Entry: 1c30 (more details), 2 Å

PDB Description: crystal structure of carbamoyl phosphate synthetase: small subunit mutation c269s

SCOP Domain Sequences for d1c30d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c30d1 c.8.3.1 (D:2-152) Carbamoyl phosphate synthetase, small subunit N-terminal domain {Escherichia coli}
iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
lrekgaqngciiagdnpdaalalekarafpg

SCOP Domain Coordinates for d1c30d1:

Click to download the PDB-style file with coordinates for d1c30d1.
(The format of our PDB-style files is described here.)

Timeline for d1c30d1: