Lineage for d4fkea2 (4fke A:283-544)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2206178Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2206179Protein automated matches [190805] (17 species)
    not a true protein
  7. 2206299Species Pig (Sus scrofa) [TaxId:9823] [311378] (11 PDB entries)
  8. 2206300Domain d4fkea2: 4fke A:283-544 [307363]
    Other proteins in same PDB: d4fkea1, d4fkea3, d4fkea4, d4fkea5
    automated match to d4fyta2
    complexed with nag, zn

Details for d4fkea2

PDB Entry: 4fke (more details), 1.85 Å

PDB Description: crystal structure of porcine aminopeptidase-n
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4fkea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fkea2 d.92.1.0 (A:283-544) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
qsvnetaqngvliriwarpnaiaeghgmyalnvtgpilnffanhyntsyplpksdqialp
dfnagamenwglvtyrenallfdpqsssisnkervvtviahelahqwfgnlvtlawwndl
wlnegfasyveylgadhaeptwnlkdlivpgdvyrvmavdalasshplttpaeevntpaq
isemfdsisyskgasvirmlsnfltedlfkeglasylhafayqnttyldlwehlqkavda
qtsirlpdtvraimdrwtlqmg

SCOPe Domain Coordinates for d4fkea2:

Click to download the PDB-style file with coordinates for d4fkea2.
(The format of our PDB-style files is described here.)

Timeline for d4fkea2: