Lineage for d4fc2b_ (4fc2 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120592Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 2120593Superfamily c.50.1: Macro domain-like [52949] (4 families) (S)
  5. 2120716Family c.50.1.3: Poly(ADP-ribose) glycohydrolase (PARG) catalytic domain-like [310642] (2 protein domains)
    Pfam PF05028
    Contains N- and C-terminal extensions to macrodomain, including Tyr clasp, discussed in PubMed 22609859
  6. 2120717Protein Poly(ADP-ribose) glycohydrolase (PARG) catalytic domain [310785] (3 species)
  7. 2120718Species Mouse (Mus musculus) [TaxId:10090] [311376] (7 PDB entries)
  8. 2120720Domain d4fc2b_: 4fc2 B: [307354]
    automated match to d3ueka_
    complexed with so4

Details for d4fc2b_

PDB Entry: 4fc2 (more details), 1.91 Å

PDB Description: Crystal structure of mouse poly(ADP-ribose) glycohydrolase (PARG) catalytic domain
PDB Compounds: (B:) Poly(ADP-ribose) glycohydrolase

SCOPe Domain Sequences for d4fc2b_:

Sequence, based on SEQRES records: (download)

>d4fc2b_ c.50.1.3 (B:) Poly(ADP-ribose) glycohydrolase (PARG) catalytic domain {Mouse (Mus musculus) [TaxId: 10090]}
pekkwlgtpieemrkmprcgihlpslrpsashtvtvrvdllragevpkpfpthykdlwdn
khvkmpcseqnlypvedengertagsrweliqtallnkftrpqnlkdailkynvayskkw
dftalvdfwdkvleeaeaqhlyqsilpdmvkialclpnictqpipllkqkmnhsvtmsqe
qiasllanaffctfprrnakmkseyssypdinfnrlfegrssrkpeklktlfcyfrrvte
kkptglvtftrqsledfpewercekpltrlhvtyegtiegngrgmlqvdfanrfvgggvt
gaglvqeeirflinpelivsrlftevldhnecliitgteqyseytgyaetyrwarshedg
sekddwqrrcteivaidalhfrryldqfvpekvrrelnkaycgflrpgvpsenlsavatg
nwgcgafggdarlkaliqilaaaaaerdvvyftfgdselmrdiysmhtflterkldvgkv
yklllryyneecrncstpgpdiklypfiyhavessa

Sequence, based on observed residues (ATOM records): (download)

>d4fc2b_ c.50.1.3 (B:) Poly(ADP-ribose) glycohydrolase (PARG) catalytic domain {Mouse (Mus musculus) [TaxId: 10090]}
pekkwlgtpieemrkmprcgihlpslrpsashtvtvrvdllragevpkpfpthykdlwdn
khvkmpcseqnlypagsrweliqtallnkftrpqnlkdailkynvayskkwdftalvdfw
dkvleeaeaqhlyqsilpdmvkialclpnictqpipllkqkmnhsvtmsqeqiasllana
ffctfprrnakmkseyssypdinfnrlfegrssrkpeklktlfcyfrrvtekkptglvtf
trqsledfpewercekpltrlhvtyegtiegngrgmlqvdfanrfvgggvtgaglvqeei
rflinpelivsrlftevldhnecliitgteqyseytgyaetyrwarshedgsekddwqrr
cteivaidalhfrryldqfvpekvrrelnkaycgflrpgvpsenlsavatgnwgcgafgg
darlkaliqilaaaaaerdvvyftfgdselmrdiysmhtflterkldvgkvyklllryyn
eecrncstpgpdiklypfiyhavessa

SCOPe Domain Coordinates for d4fc2b_:

Click to download the PDB-style file with coordinates for d4fc2b_.
(The format of our PDB-style files is described here.)

Timeline for d4fc2b_:

  • d4fc2b_ is new in SCOPe 2.06-stable