Lineage for d4f3aa_ (4f3a A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066532Superfamily b.69.15: Retinal pigment epithelial membrane protein-like [310595] (1 family) (S)
    Pfam PF03055
  5. 2066533Family b.69.15.1: RPE65-like [310643] (2 protein domains)
  6. 2066534Protein RPE65 [310786] (2 species)
  7. 2066535Species Cow (Bos taurus) [TaxId:9913] [311043] (8 PDB entries)
  8. 2066545Domain d4f3aa_: 4f3a A: [307344]
    automated match to d3fsna_
    complexed with fe2, ir3

Details for d4f3aa_

PDB Entry: 4f3a (more details), 2.6 Å

PDB Description: structure of rpe65: p6522 crystal form, iridium derivative
PDB Compounds: (A:) Retinoid isomerohydrolase

SCOPe Domain Sequences for d4f3aa_:

Sequence, based on SEQRES records: (download)

>d4f3aa_ b.69.15.1 (A:) RPE65 {Cow (Bos taurus) [TaxId: 9913]}
qvehpaggykklfetveelsspltahvtgriplwltgsllrcgpglfevgsepfyhlfdg
qallhkfdfkeghvtyhrrfirtdayvramtekrivitefgtcafpdpcknifsrffsyf
rgvevtdnalvniypvgedyyactetnfitkvnpetletikqvdlcnyvsvngatahphi
endgtvynigncfgknfsiaynivkipplqadkedpiskseivvqfpcsdrfkpsyvhsf
gltpnyivfvetpvkinlfkflsswslwganymdcfesnetmgvwlhiadkkrkkyinnk
yrtspfnlfhhintyedheflivdlccwkgfefvynylylanlrenweevkknarkapqp
evrryvlplnidkadtgknlvtlpnttatailcsdetiwlepevlfsgprqafefpqiny
qkyggkpytyayglglnhfvpdrlcklnvktketwvwqepdsypsepifvshpdaleedd
gvvlsvvvspgagqkpayllilnakdlsevaraeveinipvtfhglfkks

Sequence, based on observed residues (ATOM records): (download)

>d4f3aa_ b.69.15.1 (A:) RPE65 {Cow (Bos taurus) [TaxId: 9913]}
qvehpaggykklfetveelsspltahvtgriplwltgsllrcgpglfevgsepfyhlfdg
qallhkfdfkeghvtyhrrfirtdayvramtekrivitefgtcafpgvevtdnalvniyp
vgedyyactetnfitkvnpetletikqvdlcnyvsvngatahphiendgtvynigncfgk
nfsiaynivkipplqadkedpiskseivvqfpcsdrfkpsyvhsfgltpnyivfvetpvk
inlfkflsswslwganymdcfesnetmgvwlhiadkkrkkyinnkyrtspfnlfhhinty
edheflivdlccwkgfefvynylylanlrenweevkknarkapqpevrryvlplnidkad
tgknlvtlpnttatailcsdetiwlepevlfsgprqafefpqinyqkyggkpytyayglg
lnhfvpdrlcklnvktketwvwqepdsypsepifvshpdaleeddgvvlsvvvspgagqk
payllilnakdlsevaraeveinipvtfhglfkks

SCOPe Domain Coordinates for d4f3aa_:

Click to download the PDB-style file with coordinates for d4f3aa_.
(The format of our PDB-style files is described here.)

Timeline for d4f3aa_:

  • d4f3aa_ is new in SCOPe 2.06-stable