Lineage for d4f2ze_ (4f2z E:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066532Superfamily b.69.15: Retinal pigment epithelial membrane protein-like [310595] (1 family) (S)
    Pfam PF03055
  5. 2066533Family b.69.15.1: RPE65-like [310643] (2 protein domains)
  6. 2066561Protein automated matches [310886] (2 species)
    not a true protein
  7. 2066562Species Cow (Bos taurus) [TaxId:9913] [311375] (6 PDB entries)
  8. 2066572Domain d4f2ze_: 4f2z E: [307342]
    automated match to d3fsna_
    complexed with fe2

Details for d4f2ze_

PDB Entry: 4f2z (more details), 3 Å

PDB Description: Crystal structure of RPE65 in a lipid environment
PDB Compounds: (E:) Retinoid isomerohydrolase

SCOPe Domain Sequences for d4f2ze_:

Sequence, based on SEQRES records: (download)

>d4f2ze_ b.69.15.1 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
sqvehpaggykklfetveelsspltahvtgriplwltgsllrcgpglfevgsepfyhlfd
gqallhkfdfkeghvtyhrrfirtdayvramtekrivitefgtcafpdpcknifsrffsy
frgvevtdnalvniypvgedyyactetnfitkvnpetletikqvdlcnyvsvngatahph
iendgtvynigncfgknfsiaynivkipplqadkedpiskseivvqfpcsdrfkpsyvhs
fgltpnyivfvetpvkinlfkflsswslwganymdcfesnetmgvwlhiadkkrkkyinn
kyrtspfnlfhhintyedheflivdlccwkgfefvynylylanlrenweevkknarkapq
pevrryvlplnidkadtgknlvtlpnttatailcsdetiwlepevlfsgprqafefpqin
yqkyggkpytyayglglnhfvpdrlcklnvktketwvwqepdsypsepifvshpdaleed
dgvvlsvvvspgagqkpayllilnakdlsevaraeveinipvtfhglfkks

Sequence, based on observed residues (ATOM records): (download)

>d4f2ze_ b.69.15.1 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
sqvehpaggykklfetveelsspltahvtgriplwltgsllrcgpglfevgsepfyhlfd
gqallhkfdfkeghvtyhrrfirtdayvramtekrivitefgtcafpdvevtdnalvniy
pvgedyyactetnfitkvnpetletikqvdlcnyvsvngatahphiendgtvynigncfg
knfsiaynivkipplqadkedpiskseivvqfpcsdrfkpsyvhsfgltpnyivfvetpv
kinlfkflsswslwganymdcfesnetmgvwlhiadkkrkkyinnkyrtspfnlfhhint
yedheflivdlccwkgfefvynylylanlrenweevkknarkapqpevrryvlplnidka
dtgknlvtlpnttatailcsdetiwlepevlfsgprqafefpqinyqkyggkpytyaygl
glnhfvpdrlcklnvktketwvwqepdsypsepifvshpdaleeddgvvlsvvvspgagq
kpayllilnakdlsevaraeveinipvtfhglfkks

SCOPe Domain Coordinates for d4f2ze_:

Click to download the PDB-style file with coordinates for d4f2ze_.
(The format of our PDB-style files is described here.)

Timeline for d4f2ze_:

  • d4f2ze_ is new in SCOPe 2.06-stable