| Class g: Small proteins [56992] (100 folds) |
| Fold g.97: Iron-sulfur cluster-binding zinc finger CDGSH type [310565] (1 superfamily) Fe-S binding region and beta cap |
Superfamily g.97.1: Iron-sulfur cluster-binding zinc finger CDGSH type [310593] (2 families) ![]() Pfam PF09360; PubMed 17766440 |
| Family g.97.1.1: Outer mitochondrial membrane protein mitoNEET-like [310640] (2 proteins) |
| Protein automated matches [310858] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [311238] (13 PDB entries) |
| Domain d4f1eo_: 4f1e O: [307333] automated match to d2qh7b_ complexed with fes; mutant |
PDB Entry: 4f1e (more details), 2.4 Å
SCOPe Domain Sequences for d4f1eo_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f1eo_ g.97.1.1 (O:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlhiqkdnpkivhafdmedlggkavycrcwrskkfpfcdgahtkhneetgdnvgpliikk
ke
Timeline for d4f1eo_: