Lineage for d4f1eg_ (4f1e G:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3039055Fold g.97: Iron-sulfur cluster-binding zinc finger CDGSH type [310565] (1 superfamily)
    Fe-S binding region and beta cap
  4. 3039056Superfamily g.97.1: Iron-sulfur cluster-binding zinc finger CDGSH type [310593] (2 families) (S)
    Pfam PF09360; PubMed 17766440
  5. 3039057Family g.97.1.1: Outer mitochondrial membrane protein mitoNEET-like [310640] (2 proteins)
  6. 3039062Protein automated matches [310858] (1 species)
    not a true protein
  7. 3039063Species Human (Homo sapiens) [TaxId:9606] [311238] (13 PDB entries)
  8. 3039094Domain d4f1eg_: 4f1e G: [307325]
    automated match to d2qh7b_
    complexed with fes; mutant

Details for d4f1eg_

PDB Entry: 4f1e (more details), 2.4 Å

PDB Description: The Crystal Structure of a Human MitoNEET mutant with Asp 67 replaced by a Gly
PDB Compounds: (G:) CDGSH iron-sulfur domain-containing protein 1

SCOPe Domain Sequences for d4f1eg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f1eg_ g.97.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kaminlhiqkdnpkivhafdmedlggkavycrcwrskkfpfcdgahtkhneetgdnvgpl
iikkke

SCOPe Domain Coordinates for d4f1eg_:

Click to download the PDB-style file with coordinates for d4f1eg_.
(The format of our PDB-style files is described here.)

Timeline for d4f1eg_: