Lineage for d4f05a_ (4f05 A:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2255095Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 2255096Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 2255097Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 2255115Protein Bacterial ba3 type cytochrome c oxidase subunit I [81438] (1 species)
  7. 2255116Species Thermus thermophilus [TaxId:274] [81437] (29 PDB entries)
  8. 2255128Domain d4f05a_: 4f05 A: [307316]
    Other proteins in same PDB: d4f05b1, d4f05b2
    automated match to d1xmea_
    complexed with cu, cua, has, hem, olc; mutant

Details for d4f05a_

PDB Entry: 4f05 (more details), 2.8 Å

PDB Description: Structure of Recombinant Cytochrome ba3 Oxidase mutant Y133F from Thermus thermophilus
PDB Compounds: (A:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d4f05a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f05a_ f.24.1.1 (A:) Bacterial ba3 type cytochrome c oxidase subunit I {Thermus thermophilus [TaxId: 274]}
srvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqg
ltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpllane
atvlftfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavv
fwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpayaiiy
tilpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavp
slmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnas
ftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlw
flgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiygl
fsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvq
lfghlnpvpgwrlw

SCOPe Domain Coordinates for d4f05a_:

Click to download the PDB-style file with coordinates for d4f05a_.
(The format of our PDB-style files is described here.)

Timeline for d4f05a_: