SCOPe 2.08: Domain d4ezfb_: 4ezf B:

Lineage for d4ezfb_ (4ezf B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.97: Iron-sulfur cluster-binding zinc finger CDGSH type [310565] (1 superfamily)
   Fe-S binding region and beta cap

4. Superfamily g.97.1: Iron-sulfur cluster-binding zinc finger CDGSH type [310593] (2 families)
   Pfam PF09360; PubMed 17766440

5. Family g.97.1.1: Outer mitochondrial membrane protein mitoNEET-like [310640] (2 proteins)

6. Protein automated matches [310858] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [311238] (13 PDB entries)

8. Domain d4ezfb_: 4ezf B: [307315]
   automated match to d2qh7b_
   complexed with fes; mutant

Details for d4ezfb_

PDB Entry: 4ezf, 1.19 Å

PDB Description: The Crystal Structure of a Human MitoNEET mutant with an Ala inserted between Asp 67 and Lys 68

PDB Compounds: (B:) CDGSH iron-sulfur domain-containing protein 1

SCOPe Domain Sequences for d4ezfb_:

Sequence; same for both SEQRES and ATOM records:

>d4ezfb_ g.97.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kaminlhiqkdnpkivhafdmedlgdakavycrcwrskkfpfcdgahtkhneetgdnvgp
liikkk

Timeline for d4ezfb_:

• d4ezfb_ first appeared in SCOPe 2.06
  
• d4ezfb_ appears in SCOPe 2.07