SCOPe 2.06: Domain d4eslb2: 4esl B:41-168

Lineage for d4eslb2 (4esl B:41-168)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (35 PDB entries)

8. Domain d4eslb2: 4esl B:41-168 [307307]
   Other proteins in same PDB: d4esla_, d4eslb1
   automated match to d1ehkb1
   complexed with cu, cua, has, hem, olc; mutant

Details for d4eslb2

PDB Entry: 4esl, 2.8 Å

PDB Description: Structure of Recombinant Cytochrome ba3 Oxidase mutant Y133W+T231F from Thermus thermophilus

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d4eslb2:

Sequence; same for both SEQRES and ATOM records:

>d4eslb2 b.6.1.2 (B:41-168) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}
tagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqg
aeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglghqnm
fgtivvke

Timeline for d4eslb2:

• d4eslb2 is new in SCOPe 2.06-stable
  
• d4eslb2 appears in SCOPe 2.07
  
• d4eslb2 appears in the current release, SCOPe 2.08