Lineage for d4ei3a2 (4ei3 A:413-577)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874827Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2875028Superfamily c.44.3: PIWI domain N-terminal-like [310581] (2 families) (S)
  5. 2875029Family c.44.3.1: PIWI domain N-terminal [310609] (4 proteins)
    PubMed 15565169 notes that both halves of PIWI are usually a single evolutionary unit; however, fragments have been characterized separately. The C-terminal half is (c.55.3.10)
  6. 2875043Protein Argonaute-2 [310718] (1 species)
    Pfam PF16487
  7. 2875044Species Human (Homo sapiens) [TaxId:9606] [310964] (12 PDB entries)
  8. 2875071Domain d4ei3a2: 4ei3 A:413-577 [307301]
    Other proteins in same PDB: d4ei3a1, d4ei3a3
    automated match to d4olaa2
    protein/RNA complex; complexed with trp

Details for d4ei3a2

PDB Entry: 4ei3 (more details), 2.89 Å

PDB Description: Crystal Structure of Human Argonaute2
PDB Compounds: (A:) Protein argonaute-2

SCOPe Domain Sequences for d4ei3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ei3a2 c.44.3.1 (A:413-577) Argonaute-2 {Human (Homo sapiens) [TaxId: 9606]}
lqppsilyggrnkaiatpvqgvwdmrnkqfhtgieikvwaiacfapqrqctevhlksfte
qlrkisrdagmpiqgqpcfckyaqgadsvepmfrhlkntyaglqlvvvilpgktpvyaev
krvgdtvlgmatqcvqmknvqrttpqtlsnlclkinvklggvnni

SCOPe Domain Coordinates for d4ei3a2:

Click to download the PDB-style file with coordinates for d4ei3a2.
(The format of our PDB-style files is described here.)

Timeline for d4ei3a2: