SCOPe 2.06: Domain d4efag_: 4efa G:

Lineage for d4efag_ (4efa G:)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.37: V-type ATPase peripheral stalk subunit G coiled coil [310579] (1 family)
   Unusual right-handed coiled coil noted in PubMed 20173764

5. Family h.1.37.1: V-type ATPase peripheral stalk subunit G coiled coil [310619] (2 proteins)

6. Protein automated matches [310885] (1 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [311372] (2 PDB entries)

8. Domain d4efag_: 4efa G: [307296]
   Other proteins in same PDB: d4efae1, d4efae2
   automated match to d3j9th_
   complexed with so4

Details for d4efag_

PDB Entry: 4efa, 2.82 Å

PDB Description: crystal structure of the heterotrimeric egchead peripheral stalk complex of the yeast vacuolar atpase - second conformation

PDB Compounds: (G:) V-type proton ATPase subunit G

SCOPe Domain Sequences for d4efag_:

Sequence, based on SEQRES records:

>d4efag_ h.1.37.1 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sqkngiatllqaekeaheivskarkyrqdklkqaktdaakeidsykiqkdkelkefeqkn
aggvgelekkaeagvqgelaeikkiaekkkddvvkilietvikp

Sequence, based on observed residues (ATOM records):

>d4efag_ h.1.37.1 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sqkngiatllqaekeaheivskarkyrqdklkqaktdaakeidsykiqkdkelkefeqkn
kaeagvqgelaeikkiaekkkddvvkilietvikp

Timeline for d4efag_:

• d4efag_ is new in SCOPe 2.06-stable
  
• d4efag_ appears in SCOPe 2.07
  
• d4efag_ appears in the current release, SCOPe 2.08