Lineage for d4efag_ (4efa G:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2590058Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2591482Superfamily h.1.37: V-type ATPase peripheral stalk subunit G coiled coil [310579] (1 family) (S)
    Unusual right-handed coiled coil noted in PubMed 20173764
  5. 2591483Family h.1.37.1: V-type ATPase peripheral stalk subunit G coiled coil [310619] (2 proteins)
  6. 2591492Protein automated matches [310885] (1 species)
    not a true protein
  7. 2591493Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [311372] (2 PDB entries)
  8. 2591494Domain d4efag_: 4efa G: [307296]
    Other proteins in same PDB: d4efae1, d4efae2
    automated match to d3j9th_
    complexed with so4

Details for d4efag_

PDB Entry: 4efa (more details), 2.82 Å

PDB Description: crystal structure of the heterotrimeric egchead peripheral stalk complex of the yeast vacuolar atpase - second conformation
PDB Compounds: (G:) V-type proton ATPase subunit G

SCOPe Domain Sequences for d4efag_:

Sequence, based on SEQRES records: (download)

>d4efag_ h.1.37.1 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sqkngiatllqaekeaheivskarkyrqdklkqaktdaakeidsykiqkdkelkefeqkn
aggvgelekkaeagvqgelaeikkiaekkkddvvkilietvikp

Sequence, based on observed residues (ATOM records): (download)

>d4efag_ h.1.37.1 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sqkngiatllqaekeaheivskarkyrqdklkqaktdaakeidsykiqkdkelkefeqkn
kaeagvqgelaeikkiaekkkddvvkilietvikp

SCOPe Domain Coordinates for d4efag_:

Click to download the PDB-style file with coordinates for d4efag_.
(The format of our PDB-style files is described here.)

Timeline for d4efag_: