Lineage for d4efae2 (4efa E:98-226)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2527131Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2527763Superfamily d.81.4: V-type ATPase subunit E-like [160527] (1 family) (S)
    extra N-terminal helix and extra C-terminal helix form dimerisation subdomain
  5. 2527764Family d.81.4.1: V-type ATPase subunit E C-terminal domain [160528] (1 protein)
    Pfam PF01991
  6. 2527765Protein V-type ATPase subunit E C-terminal domain [160529] (3 species)
  7. 2527766Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310947] (3 PDB entries)
  8. 2527767Domain d4efae2: 4efa E:98-226 [307295]
    Other proteins in same PDB: d4efae1, d4efag_
    automated match to d3j9tg1
    complexed with so4

Details for d4efae2

PDB Entry: 4efa (more details), 2.82 Å

PDB Description: crystal structure of the heterotrimeric egchead peripheral stalk complex of the yeast vacuolar atpase - second conformation
PDB Compounds: (E:) V-type proton ATPase subunit E

SCOPe Domain Sequences for d4efae2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4efae2 d.81.4.1 (E:98-226) V-type ATPase subunit E C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gifeetkeklsgiannrdeykpilqsliveallkllepkaivkalerdvdliesmkddim
reygekaqrapleeivisndylnkdlvsggvvvsnasdkieinntleerlkllseealpa
irlelygps

SCOPe Domain Coordinates for d4efae2:

Click to download the PDB-style file with coordinates for d4efae2.
(The format of our PDB-style files is described here.)

Timeline for d4efae2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4efae1
View in 3D
Domains from other chains:
(mouse over for more information)
d4efag_