SCOPe 2.08: Domain d4efae1: 4efa E:2-97

Lineage for d4efae1 (4efa E:2-97)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.36: V-type ATPase peripheral stalk subunit E coiled coil [310578] (1 family)
   Unusual right-handed coiled coil noted in PubMed 20173764

5. Family h.1.36.1: V-type ATPase peripheral stalk subunit E coiled coil [310618] (1 protein)

6. Protein V-type ATPase peripheral stalk subunit E coiled coil [310711] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310949] (3 PDB entries)

8. Domain d4efae1: 4efa E:2-97 [307294]
   Other proteins in same PDB: d4efae2, d4efag_
   automated match to d3j9tg2
   complexed with so4

Details for d4efae1

PDB Entry: 4efa, 2.82 Å

PDB Description: crystal structure of the heterotrimeric egchead peripheral stalk complex of the yeast vacuolar atpase - second conformation

PDB Compounds: (E:) V-type proton ATPase subunit E

SCOPe Domain Sequences for d4efae1:

Sequence; same for both SEQRES and ATOM records:

>d4efae1 h.1.36.1 (E:2-97) V-type ATPase peripheral stalk subunit E coiled coil {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ssaitaltpnqvndelnkmqafirkeaeekakeiqlkadqeyeiektnivrnetnnidgn
fksklkkamlsqqitkstiankmrlkvlsareqsld

Timeline for d4efae1:

• d4efae1 first appeared in SCOPe 2.06
  
• d4efae1 appears in SCOPe 2.07