Lineage for d4efae1 (4efa E:2-97)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2590058Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2591469Superfamily h.1.36: V-type ATPase peripheral stalk subunit E coiled coil [310578] (1 family) (S)
    Unusual right-handed coiled coil noted in PubMed 20173764
  5. 2591470Family h.1.36.1: V-type ATPase peripheral stalk subunit E coiled coil [310618] (1 protein)
  6. 2591471Protein V-type ATPase peripheral stalk subunit E coiled coil [310711] (2 species)
  7. 2591472Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310949] (3 PDB entries)
  8. 2591473Domain d4efae1: 4efa E:2-97 [307294]
    Other proteins in same PDB: d4efae2, d4efag_
    automated match to d3j9tg2
    complexed with so4

Details for d4efae1

PDB Entry: 4efa (more details), 2.82 Å

PDB Description: crystal structure of the heterotrimeric egchead peripheral stalk complex of the yeast vacuolar atpase - second conformation
PDB Compounds: (E:) V-type proton ATPase subunit E

SCOPe Domain Sequences for d4efae1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4efae1 h.1.36.1 (E:2-97) V-type ATPase peripheral stalk subunit E coiled coil {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ssaitaltpnqvndelnkmqafirkeaeekakeiqlkadqeyeiektnivrnetnnidgn
fksklkkamlsqqitkstiankmrlkvlsareqsld

SCOPe Domain Coordinates for d4efae1:

Click to download the PDB-style file with coordinates for d4efae1.
(The format of our PDB-style files is described here.)

Timeline for d4efae1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4efae2
View in 3D
Domains from other chains:
(mouse over for more information)
d4efag_