| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.36: V-type ATPase peripheral stalk subunit E coiled coil [310578] (1 family) ![]() Unusual right-handed coiled coil noted in PubMed 20173764 |
| Family h.1.36.1: V-type ATPase peripheral stalk subunit E coiled coil [310618] (1 protein) |
| Protein V-type ATPase peripheral stalk subunit E coiled coil [310711] (2 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310949] (3 PDB entries) |
| Domain d4efae1: 4efa E:2-97 [307294] Other proteins in same PDB: d4efae2, d4efag_ automated match to d3j9tg2 complexed with so4 |
PDB Entry: 4efa (more details), 2.82 Å
SCOPe Domain Sequences for d4efae1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4efae1 h.1.36.1 (E:2-97) V-type ATPase peripheral stalk subunit E coiled coil {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ssaitaltpnqvndelnkmqafirkeaeekakeiqlkadqeyeiektnivrnetnnidgn
fksklkkamlsqqitkstiankmrlkvlsareqsld
Timeline for d4efae1: