Lineage for d4ef7b_ (4ef7 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2095073Species Human (Homo sapiens) [TaxId:9606] [186944] (46 PDB entries)
  8. 2095117Domain d4ef7b_: 4ef7 B: [307293]
    automated match to d2hunb_
    complexed with gai, nad, so4

Details for d4ef7b_

PDB Entry: 4ef7 (more details), 2.5 Å

PDB Description: UDP-xylose synthase
PDB Compounds: (B:) UDP-glucuronic acid decarboxylase 1

SCOPe Domain Sequences for d4ef7b_:

Sequence, based on SEQRES records: (download)

>d4ef7b_ c.2.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkrilitggagfvgshltdklmmdghevtvvdnfftgrkrnvehwighenfelinhdvve
plyievdqiyhlaspasppnymynpiktlktntigtlnmlglakrvgarlllastsevyg
dpevhpqsedywghvnpigpracydegkrvaetmcyaymkqegvevrvarifntfgprmh
mndgrvvsnfilqalqgepltvygsgsqtrafqyvsdlvnglvalmnsnvsspvnlgnpe
ehtilefaqliknlvgsgseiqflseaqddpqkrkpdikkaklmlgwepvvpleeglnka
ihyfrkeleyq

Sequence, based on observed residues (ATOM records): (download)

>d4ef7b_ c.2.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkrilitggagfvgshltdklmmdghevtvvdnfftgrkrnvehwighenfelinhdvve
plyievdqiyhlaspaspnpiktlktntigtlnmlglakrvgarlllastsevygdpevh
pqsedywghvnpigpracydegkrvaetmcyaymkqegvevrvarifntfgprmhmndgr
vvsnfilqalqgepltvygsgsqtrafqyvsdlvnglvalmnsnvsspvnlgnpeehtil
efaqliknlvgsgseiqflseaqddpqkrkpdikkaklmlgwepvvpleeglnkaihyfr
keleyq

SCOPe Domain Coordinates for d4ef7b_:

Click to download the PDB-style file with coordinates for d4ef7b_.
(The format of our PDB-style files is described here.)

Timeline for d4ef7b_:

  • d4ef7b_ is new in SCOPe 2.06-stable