SCOPe 2.06: Domain d4ed9a_: 4ed9 A:

Lineage for d4ed9a_ (4ed9 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
   consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit

4. Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families)

5. Family c.123.1.0: automated matches [267628] (1 protein)
   not a true family

6. Protein automated matches [267679] (3 species)
   not a true protein

7. Species Brucella suis [TaxId:204722] [311374] (1 PDB entry)

8. Domain d4ed9a_: 4ed9 A: [307291]
   automated match to d4hl6b_
   complexed with edo, nhe, peg

Details for d4ed9a_

PDB Entry: 4ed9, 1.95 Å

PDB Description: Crystal structure of a CAIB/BAIF family protein from Brucella suis

PDB Compounds: (A:) CAIB/BAIF family protein

SCOPe Domain Sequences for d4ed9a_:

Sequence; same for both SEQRES and ATOM records:

>d4ed9a_ c.123.1.0 (A:) automated matches {Brucella suis [TaxId: 204722]}
qntpldglkvvelarilagpwvgqtlcdlgadvikvespegddtrtwgppfidvegersa
ayfhacnrgkrsitadfrteegrelvrrlvaeadvvienfklggldkygldyeslkainp
qliycsitgfghtgpyaeragydfmiqgmggimdltgepdrepqkigvafadiftglysv
iaiqsalimrartgkgqhidmalfdcmsgvlanqamnylasgkspkrmgnahpniapyqt
lsvsdgyfiiacgndgqfgklstllgigelakderfatnsarvanraaltalleertkqw
krddllaelakigvpagpintvadvfadpqfkargmkidpqgvpglrtpirfsdadlkld
srspklnehgaairaeld

Timeline for d4ed9a_:

• d4ed9a_ is new in SCOPe 2.06-stable
  
• d4ed9a_ appears in SCOPe 2.07
  
• d4ed9a_ appears in the current release, SCOPe 2.08