Lineage for d1fgh_1 (1fgh 529-754)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies) 
Superfamily c.8.2: Aconitase, C-terminal domain [52016] (1 family) 
Family c.8.2.1: Aconitase, C-terminal domain [52017] (1 protein) Protein Aconitase, C-terminal domain [52018] (2 species) Species Cow (Bos taurus) [TaxId:9913] [52020] (9 PDB entries) 
Domain d1fgh_1: 1fgh 529-754 [30729]
Other proteins in same PDB: d1fgh_2
Details for d1fgh_1
PDB Entry: 1fgh (more details), 2.05 Å
PDB Description: complex with 4-hydroxy-trans-aconitate
SCOP Domain Sequences for d1fgh_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fgh_1 c.8.2.1 (529-754) Aconitase, C-terminal domain {Cow (Bos taurus)}
vdvsptsqrlqllepfdkwdgkdledlqilikvkgkcttdhisaagpwlkfrghldnisn
nlligainsenrkansvrnavtqefgpvpdtaryykqhgirwvvigdenygegssrehsa
leprflggraiitksfarihetnlkkqgllpltfadpadynkihpvdkltiqglkdfapg
kpltciikhpngtqetillnhtfnetqiewfragsalnrmkelqqk
SCOP Domain Coordinates for d1fgh_1:
Click to download the PDB-style file with coordinates for d1fgh_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fgh_1:
- d1fgh_1 appears in SCOP 1.57
- d1fgh_1 appears in the current release, SCOPe 2.08, called d1fgha1
View in 3D
