Lineage for d4e9pa3 (4e9p A:336-516)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2043106Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2043107Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2043852Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2043977Protein multi-copper oxidase CueO [69194] (1 species)
  7. 2043978Species Escherichia coli [TaxId:562] [69195] (34 PDB entries)
  8. 2044041Domain d4e9pa3: 4e9p A:336-516 [307286]
    Other proteins in same PDB: d4e9pa4
    automated match to d3od3a3
    complexed with act, cu

Details for d4e9pa3

PDB Entry: 4e9p (more details), 1.6 Å

PDB Description: Multicopper Oxidase CueO (data1)
PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d4e9pa3:

Sequence, based on SEQRES records: (download)

>d4e9pa3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdhsqmmghmghgnmnh
mnhggkfdfhhankingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfril
sengkppaahragwkdtvkvegnvsevlvkfnhdapkehaymahchllehedtgmmlgft
v

Sequence, based on observed residues (ATOM records): (download)

>d4e9pa3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdhhmnhggkfdfhhan
kingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfrilsengkppaahrag
wkdtvkvegnvsevlvkfnhdapkehaymahchllehedtgmmlgftv

SCOPe Domain Coordinates for d4e9pa3:

Click to download the PDB-style file with coordinates for d4e9pa3.
(The format of our PDB-style files is described here.)

Timeline for d4e9pa3: