Lineage for d4e2wa_ (4e2w A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2146516Family c.66.1.60: C-3'-methyltransferase-like [310657] (2 proteins)
    Pfam PF08421; Pfam PF13489; Pfam PF08484 (in that order in the sequence)
  6. 2146517Protein TcaB9 [310820] (1 species)
  7. 2146518Species Micromonospora chalcea [TaxId:1874] [311087] (10 PDB entries)
  8. 2146523Domain d4e2wa_: 4e2w A: [307271]
    automated match to d3ndja_
    complexed with edo, jhz, sah, zn; mutant

Details for d4e2wa_

PDB Entry: 4e2w (more details), 1.5 Å

PDB Description: X-ray Structure of the H181N mutant of TcaB9, a C-3'-Methyltransferase, in Complex with S-Adenosyl-L-Homocysteine and Sugar Product
PDB Compounds: (A:) TcaB9

SCOPe Domain Sequences for d4e2wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e2wa_ c.66.1.60 (A:) TcaB9 {Micromonospora chalcea [TaxId: 1874]}
tacrvcgggvqefldlgrqplsdrfrkpdelddeftyrlavgrcdscemvqlteevprdl
mfhevypyhssgssvmrehfamlardflateltgpdpfiveigcndgimlrtiqeagvrh
lgfepssgvaakarekgirvrtdffekataddvrrtegpanviyaantlcnipyvqsvle
gvdallapdgvfvfedpylgdivaktsfdqiydehfflfsatsvqgmaqrcgfelvdvqr
lpvhggevrytlarqgsrtpsaavaqllaaereqelsdmatlrafagnvvkirdeltall
hrlraegrsvvgygataksatvtnfcgigpdlvhsvydttpdkqnrltpgahipvrpasa
fsdpypdyallfawnhaeeimakeqefhqaggrwilyvpevhir

SCOPe Domain Coordinates for d4e2wa_:

Click to download the PDB-style file with coordinates for d4e2wa_.
(The format of our PDB-style files is described here.)

Timeline for d4e2wa_: