Lineage for d1c96a1 (1c96 A:529-754)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21274Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 21297Superfamily c.8.2: Aconitase, C-terminal domain [52016] (1 family) (S)
  5. 21298Family c.8.2.1: Aconitase, C-terminal domain [52017] (1 protein)
  6. 21299Protein Aconitase, C-terminal domain [52018] (2 species)
  7. 21300Species Cow (Bos taurus) [TaxId:9913] [52020] (9 PDB entries)
  8. 21305Domain d1c96a1: 1c96 A:529-754 [30727]
    Other proteins in same PDB: d1c96a2

Details for d1c96a1

PDB Entry: 1c96 (more details), 1.81 Å

PDB Description: s642a:citrate complex of aconitase

SCOP Domain Sequences for d1c96a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c96a1 c.8.2.1 (A:529-754) Aconitase, C-terminal domain {Cow (Bos taurus)}
vavsptsqrlqllepfdkwdgkdledlqilikvkgkcttdhisaagpwlkfrghldnisn
nlligainienrkansvrnavtqefgpvpdtaryykqhgirwvvigdenygegasrehsa
leprhlggraiitksfarihetnlkkqgllpltfadpadynkihpvdkltiqglkdfapg
kplkciikhpngtqetillnhtfnetqiewfragsalnrmkelqqk

SCOP Domain Coordinates for d1c96a1:

Click to download the PDB-style file with coordinates for d1c96a1.
(The format of our PDB-style files is described here.)

Timeline for d1c96a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c96a2