Lineage for d1c96a1 (1c96 A:529-754)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. Superfamily c.8.2: LeuD/IlvD-like [52016] (4 families) (S)
    contains mixed beta-sheet barrel, closed n=7, S=10
  5. Family c.8.2.1: LeuD-like [52017] (4 proteins)
    Pfam PF00694; permutation of the domain order in the proteins containing this family domain
  6. Protein Aconitase A, C-terminal domain [52018] (2 species)
    other three domains have alpha/beta folds
  7. Species Cow (Bos taurus) [TaxId:9913] [52020] (9 PDB entries)
  8. Domain d1c96a1: 1c96 A:529-754 [30727]
    Other proteins in same PDB: d1c96a2
    complexed with flc, o, sf4

Details for d1c96a1

PDB Entry: 1c96 (more details), 1.81 Å

PDB Description: s642a:citrate complex of aconitase
PDB Compounds: (A:) mitochondrial aconitase

SCOPe Domain Sequences for d1c96a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c96a1 c.8.2.1 (A:529-754) Aconitase A, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
vavsptsqrlqllepfdkwdgkdledlqilikvkgkcttdhisaagpwlkfrghldnisn
nlligainienrkansvrnavtqefgpvpdtaryykqhgirwvvigdenygegasrehsa
leprhlggraiitksfarihetnlkkqgllpltfadpadynkihpvdkltiqglkdfapg
kplkciikhpngtqetillnhtfnetqiewfragsalnrmkelqqk

SCOPe Domain Coordinates for d1c96a1 are not available.

Timeline for d1c96a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c96a2