Lineage for d4dpsa_ (4dps A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778280Protein Concanavalin A [49901] (4 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 2778281Species Brazilian jackbean (Canavalia brasiliensis) [TaxId:61861] [49903] (7 PDB entries)
  8. 2778282Domain d4dpsa_: 4dps A: [307265]
    automated match to d1azda_
    complexed with ca, dbb, mn, rib

Details for d4dpsa_

PDB Entry: 4dps (more details), 2.07 Å

PDB Description: Crystal Structure of Canavalia brasiliensis seeds lectin (ConBr) in complex with Ribose
PDB Compounds: (A:) Concanavalin-Br

SCOPe Domain Sequences for d4dpsa_:

Sequence, based on SEQRES records: (download)

>d4dpsa_ b.29.1.1 (A:) Concanavalin A {Brazilian jackbean (Canavalia brasiliensis) [TaxId: 61861]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtegnlrltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d4dpsa_ b.29.1.1 (A:) Concanavalin A {Brazilian jackbean (Canavalia brasiliensis) [TaxId: 61861]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksntn
alhfmfnqfskdqkdlilqgdattgtegnlrltrvssngspqgssvgralfyapvhiwes
savvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d4dpsa_:

Click to download the PDB-style file with coordinates for d4dpsa_.
(The format of our PDB-style files is described here.)

Timeline for d4dpsa_: